MCM8 antibody

Catalog No. ABIN4951692

Product Details anti-MCM8 Antibody

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM of human MCM8 were used as the immunogen for the MCM8 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MCM8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MCM8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MCM8

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Alternative Name: MCM8 (MCM8 Products)

Synonyms: C20orf154 antibody, dJ967N21.5 antibody, 5730432L01Rik antibody, minichromosome maintenance 8 homologous recombination repair factor antibody, minichromosome maintenance 8 homologous recombination repair factor L homeolog antibody, MCM8 antibody, Mcm8 antibody, mcm8.L antibody

Background: DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

UniProt: Q9UJA3

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA