MGST1 antibody

Catalog No. ABIN4951723

Product Details anti-MGST1 Antibody

Target: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MGST1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA of human MGST1 were used as the immunogen for the MGST1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MGST1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MGST1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MGST1

Target: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Alternative Name: MGST1 (MGST1 Products)

Synonyms: gst12 antibody, mgst antibody, mgst-i antibody, zgc:101898 antibody, MGST1 antibody, GST12 antibody, MGST antibody, MGST-I antibody, 1500002K10Rik antibody, Gst antibody, microsomal glutathione S-transferase 1 L homeolog antibody, microsomal glutathione S-transferase 1.1 antibody, microsomal glutathione S-transferase 1 pseudogene antibody, microsomal glutathione S-transferase 1 antibody, mgst1.L antibody, mgst1.1 antibody, LOC473380 antibody, MGST1 antibody, mgst1 antibody, CpipJ_CPIJ015233 antibody, CpipJ_CPIJ018241 antibody, Mgst1 antibody

Background: Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.

UniProt: P10620