PPT1 antibody

Catalog No. ABIN4952244

This Rabbit Polyclonal antibody specifically detects PPT1 in WB, FACS and IHC (p). It exhibits reactivity toward Human and Rat.

Quick Overview for PPT1 antibody (ABIN4952244)

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPT1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-PPT1 Antibody

Purpose: PPT1 Antibody

Sequence: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Purification: Antigen affinity

Immunogen: Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PPT1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the PPT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for PPT1

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Alternative Name: PPT1

Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome