SP5 antibody

Catalog No. ABIN4952680

Product Details anti-SP5 Antibody

Target: SP5 (Sp5 Transcription Factor (SP5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SP5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Sp5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Sp5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SP5

Target: SP5 (Sp5 Transcription Factor (SP5))

Alternative Name: Sp5 (SP5 Products)

Synonyms: bts1 antibody, fc39b01 antibody, wu:fc39b01 antibody, Bricd6 antibody, SP-C antibody, SP5 antibody, SPC antibody, Sftp-2 antibody, Sftp2 antibody, pro-SpC antibody, Sp5 transcription factor antibody, Sp5 transcription factor a antibody, surfactant associated protein C antibody, trans-acting transcription factor 5 antibody, Sp5 antibody, sp5a antibody, SP5 antibody, CpipJ_CPIJ003609 antibody, Sftpc antibody

Background: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

UniProt: Q6BEB4