CDK5 antibody (Cyclin-Dependent Kinase 5) (AA 1-292) Primary Antibody
-
- Target
- CDK5
- Binding Specificity
-
AA 1-292
- Reactivity
-
Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
-
This CDK5 antibody is un-conjugated
- Application
-
Immunoprecipitation (IP), Western Blotting (WB)
- Purpose
- Rabbit polyclonal antibody raised against a full-length human CDK5 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
-
immunogen: CDK5 (NP_004926.1, 1 a.a. ~ 292 a.a) full-length human protein.
Immunogen Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- No additive
- Preservative
- Without preservative
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- CDK5
- Alternative Name
- CDK5 (CDK5 Antibody Abstract)
- Synonyms
- PSSALRE, AW048668, Crk6, CDK5, CG8203, DmCdk5, Dmel\\CG8203, cdk5, zgc:101604, cyclin dependent kinase 5, cyclin-dependent kinase 5, Cyclin-dependent kinase 5, cyclin-dependent kinase 5 L homeolog, Cyclin-dependent-like kinase 5, CDK5, Cdk5, cdk5, cdk5.L, cdk-5
- Background
-
Full Gene Name: cyclin-dependent kinase 5
Synonyms: PSSALRE - Gene ID
- 1020
- NCBI Accession
- NP_004926, NM_004935
- Pathways
- Cell Division Cycle, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of Cell Size, Skeletal Muscle Fiber Development, Synaptic Vesicle Exocytosis