CDK5 antibody (Cyclin-Dependent Kinase 5) (AA 1-292)

Catalog No. ABIN514280

Product Details anti-CDK5 Antibody

Target: CDK5

See all CDK5 Antibodies

Binding Specificity: AA 1-292

See all available epitopes across CDK5 antibodies

• pTyr15 22
• AA 1-45 15
• C-Term 15
• N-Term 14
• AA 1-292 8
• pSer159 8
• AA 160-286 4
• AA 92-273 4
• AA 195-292 3
• AA 225-260 3
• AA 60-110 3
• AA 1-138 2
• AA 1-50 2
• AA 1-80 2
• AA 254-289 2
• AA 273-292 2
• AA 1-10 1
• AA 1-226 1
• AA 101-150 1
• AA 11-60 1
• AA 15-64 1
• AA 268-283 1
• Internal Region 1
• Middle Region 1
• Ser23 1
• Tyr15 1
• pThr15 1

Reactivity: Human

See all available reactivities across CDK5 antibodies

• Human 159
• Mouse 113
• Rat 101
• Cow 18
• Monkey 15
• Pig 15
• Zebrafish (Danio rerio) 15
• Dog 14
• Chicken 13
• Sheep 12
• Horse 9
• Rabbit 9
• Guinea Pig 5
• Xenopus laevis 5
• Bat 3
• Drosophila melanogaster 3
• Hamster 3
• Saccharomyces cerevisiae 2
• C. elegans 1
• Fish 1
• Insect 1

Host: Mouse

Clonality: Polyclonal

Conjugate: This CDK5 antibody is un-conjugated

See all available conjugates across CDK5 antibodies

• Un-conjugated 99
• Biotin 11
• Alexa Fluor 750 6
• Alexa Fluor 488 5
• Alexa Fluor 555 5
• Alexa Fluor 594 5
• Alexa Fluor 647 5
• Alexa Fluor 680 5
• FITC 5
• HRP 4
• Alexa Fluor 350 2
• Cy3 2
• Cy5 2
• Cy5.5 2
• Cy7 2
• KLH 1

Application: Immunofluorescence (IF), Western Blotting (WB)

See all available applications across CDK5 antibodies

• Western Blotting (WB) 117
• ELISA 55
• Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 27
• Immunohistochemistry (IHC) 27
• Immunofluorescence (IF) 22
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 21
• Immunoprecipitation (IP) 19
• Flow Cytometry (FACS) 14
• Immunocytochemistry (ICC) 14
• Immunofluorescence (fixed cells) (IF/ICC) 4
• Enzyme Immunoassay (EIA) 3
• Immunochromatography (IC) 3
• Immunohistochemistry (Frozen Sections) (IHC (fro)) 1

Purpose: Mouse polyclonal antibody raised against a full-length human CDK5 protein.

Brand: MaxPab®

Cross-Reactivity: Human, Rat (Rattus)

Immunogen:

immunogen: CDK5 (NP_004926.1, 1 a.a. ~ 292 a.a) full-length human protein.

Immunogen Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions: For Research Use only

Handling

Buffer: In 1x PBS, pH 7.4

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Target Details for CDK5

Target: CDK5

Alternative Name: CDK5 (CDK5 Antibody Abstract)

Synonyms: PSSALRE, AW048668, Crk6, CDK5, CG8203, DmCdk5, Dmel\\CG8203, cdk5, zgc:101604, cyclin dependent kinase 5, cyclin-dependent kinase 5, Cyclin-dependent kinase 5, cyclin-dependent kinase 5 L homeolog, Cyclin-dependent-like kinase 5, CDK5, Cdk5, cdk5, cdk5.L, cdk-5

Background: Full Gene Name: cyclin-dependent kinase 5
Synonyms: PSSALRE

Gene ID: 1020

NCBI Accession: NP_004926, NM_004935

Pathways: Cell Division Cycle, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of Cell Size, Skeletal Muscle Fiber Development, Synaptic Vesicle Exocytosis