Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HSD11B1 antibody (Hydroxysteroid (11-Beta) Dehydrogenase 1) (AA 1-292) Primary Antibody

HSD11B1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 2C10 unconjugated
Catalog No. ABIN516704
$600.00
Plus shipping costs $45.00
200 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    HSD11B1
    Binding Specificity
    • 8
    • 8
    • 6
    • 5
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-292
    Reactivity
    • 57
    • 31
    • 26
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 49
    • 14
    • 3
    Mouse
    Clonality
    • 58
    • 8
    Monoclonal
    Conjugate
    • 33
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This HSD11B1 antibody is un-conjugated
    Application
    • 46
    • 30
    • 16
    • 9
    • 6
    • 6
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a full length recombinant HSD11B1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: HSD11B1 (AAH12593, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

    Clone
    2C10
    Isotype
    IgM kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In ascites fluid
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    HSD11B1
    Alternative Name
    HSD11B1 (HSD11B1 Antibody Abstract)
    Synonyms
    11-DH, 11-beta-HSD1, CORTRD2, HDL, HSD11, HSD11B, HSD11L, SDR26C1, hsd11, hsd11b, LRRGT00065, hydroxysteroid 11-beta dehydrogenase 1, hydroxysteroid (11-beta) dehydrogenase 1b, hydroxysteroid (11-beta) dehydrogenase 1 L homeolog, HSD11B1, HSD11B1b, hsd11b1.L, Hsd11b1
    Background
    Full Gene Name: hydroxysteroid (11-beta) dehydrogenase 1
    Synonyms: 11-DH,11-beta-HSD1,HDL,HSD11,HSD11B,HSD11L,MGC13539,SDR26C1
    Gene ID
    3290
    Pathways
    Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Carbohydrate Metabolic Process
You are here:
help Support