Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

DUOXA1 antibody (Dual Oxidase Maturation Factor 1) (AA 1-298) Primary Antibody

DUOXA1 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
Pubmed (1)
Catalog No. ABIN530004
$600.00
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    DUOXA1
    Binding Specificity
    • 4
    • 2
    • 1
    • 1
    AA 1-298
    Reactivity
    • 9
    • 2
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 8
    • 1
    Mouse
    Clonality
    • 9
    Polyclonal
    Conjugate
    • 6
    • 1
    • 1
    • 1
    This DUOXA1 antibody is un-conjugated
    Application
    • 5
    • 4
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human NIP protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: NIP (AAH20841, 1 a.a. ~ 298 a.a) full-length human protein.

    Immunogen Sequence: MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Little, Sham, Hristova, Danyal, Heppner, Bauer, Sipsey, Habibovic, van der Vliet: "DUOX1 silencing in lung cancer promotes EMT, cancer stem cell characteristics and invasive properties." in: Oncogenesis, Vol. 5, Issue 10, pp. e261, 2016 (PubMed).

  • Target
    DUOXA1
    Alternative Name
    DUOXA1 (DUOXA1 Antibody Abstract)
    Synonyms
    NIP, NUMBIP, mol, BC019755, Nip, Nip1, RGD1306601, dual oxidase maturation factor 2, dual oxidase maturation factor 1, DUOXA2, DUOXA1, LOC100405759, Duoxa1
    Background
    Full Gene Name: dual oxidase maturation factor 1
    Synonyms: FLJ32334,NIP,NUMBIP,mol
    Gene ID
    90527
You are here:
help Support