Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CRB3 antibody (Crumbs Homolog 3) (AA 1-120) Primary Antibody

CRB3 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN530104
$600.00
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    CRB3
    Binding Specificity
    • 8
    • 7
    • 7
    • 7
    • 1
    • 1
    • 1
    AA 1-120
    Reactivity
    • 26
    • 9
    Human
    Host
    • 24
    • 1
    • 1
    Mouse
    Clonality
    • 25
    • 1
    Polyclonal
    Conjugate
    • 7
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This CRB3 antibody is un-conjugated
    Application
    • 20
    • 16
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human CRB3 protein.
    Brand
    MaxPab®
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CRB3 (NP_631900.1, 1 a.a. ~ 120 a.a) full-length human protein.

    Immunogen Sequence: MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CRB3
    Alternative Name
    CRB3 (CRB3 Antibody Abstract)
    Synonyms
    5730439B18, AU015179, AU041752, crumbs family member 3, crumbs 3, cell polarity complex component, crumbs homolog 3b, Crb3, CRB3, crb3b
    Background
    Full Gene Name: crumbs homolog 3 (Drosophila)
    Synonyms:
    Gene ID
    92359
    NCBI Accession
    NP_631900, NM_139161
    Pathways
    Notch Signaling, Cell-Cell Junction Organization
You are here:
help Support