RPS6 antibody (N-Term)

Catalog No. ABIN5518869

Product Details anti-RPS6 Antibody

Target: RPS6 (Ribosomal Protein S6 (RPS6))

Binding Specificity: AA 13-52, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QKLIEVDDER KLRTFYEKRM ATEVAADALG EEWKGYVVRI

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ribosomal protein S6
Protein Name: 40S ribosomal protein S6

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for RPS6

Target: RPS6 (Ribosomal Protein S6 (RPS6))

Alternative Name: RPS6 (RPS6 Products)

Synonyms: S6 antibody, rps6 antibody, rps6a antibody, S6R antibody, (Rp)S6 antibody, CG10944 antibody, DS6 antibody, Dmel\\CG10944 antibody, M(1)7BC antibody, M(1)7C antibody, RPS6 antibody, Rp S6 antibody, Rps6 antibody, air8 antibody, air[8] antibody, anon-WO02059370.61 antibody, hen antibody, l(1)air8 antibody, l(1)air[8] antibody, l(1)hen antibody, pp30 antibody, rpS6 antibody, wu:fa92e06 antibody, wu:fb64g06 antibody, zgc:92237 antibody, ribosomal protein S6 antibody, ribosomal protein S6 S homeolog antibody, S6 ribosomal protein antibody, Ribosomal protein S6 antibody, 30S ribosomal protein S6 antibody, 40S ribosomal protein S6 antibody, RPS6 antibody, rps6.S antibody, LOC100135859 antibody, Rps6 antibody, RpS6 antibody, rps6 antibody, rps-6 antibody, LOC100533219 antibody

Background: Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

Synonyms: Air8 | NP33 | Phosphoprotein NP33 | Pp30 | RP S6 | RPS6 | RS6 | S6 | P62753

Gene ID: 6194

UniProt: P62753

Pathways: Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly