Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Adaptor Related Protein Complex 4 sigma 1 (AP4s1) antibody Primary Antibody

AP4s1 Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5572666
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Adaptor Related Protein Complex 4 sigma 1 (AP4s1)
    Reactivity
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 3
    Rabbit
    Clonality
    • 3
    Polyclonal
    Application
    • 3
    • 1
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit polyclonal antibody raised against recombinant AP4S1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human AP4S1.

    Immunogen Sequence: LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:50-1:200)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    Adaptor Related Protein Complex 4 sigma 1 (AP4s1)
    Alternative Name
    AP4S1 (AP4s1 Antibody Abstract)
    Synonyms
    AP47B, CLA20, CLAPS4, CPSQ6, SPG52, AI314282, adaptor related protein complex 4 sigma 1 subunit, adaptor-related protein complex 4, sigma 1 subunit, adaptor-related protein complex AP-4, sigma 1, AP4S1, Ap4s1
    Background
    Full Gene Name: adaptor-related protein complex 4, sigma 1 subunit
    Synonyms: AP47B,CLA20,CLAPS4,FLJ32366
    Gene ID
    11154
    UniProt
    Q9Y587
You are here:
help Support