DSCR4 antibody (Down Syndrome Critical Region Gene 4)

Catalog No. ABIN5576847

Product Details anti-DSCR4 Antibody

Target: DSCR4

See all DSCR4 Antibodies

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DSCR4 antibody is un-conjugated

See all available conjugates across DSCR4 antibodies

• Un-conjugated 1
• Biotin 1
• FITC 1
• HRP 1

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Purpose: Rabbit polyclonal antibody raised against recombinant DSCR4.

Cross-Reactivity: Human

Immunogen:

immunogen: Recombinant protein corresponding to amino acids of human DSCR4.

Immunogen Sequence: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGR

Isotype: IgG

Application Details

Application Notes: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.

Target Details for DSCR4

Target: DSCR4

Alternative Name: DSCR4 (DSCR4 Antibody Abstract)

Synonyms: DCRB, DSCRB, Down syndrome critical region 4, DSCR4

Background: Full Gene Name: Down syndrome critical region gene 4
Synonyms: DCRB,DSCRB

Gene ID: 10281

UniProt: P56555