DSCR4 antibody (Down Syndrome Critical Region Gene 4) Primary Antibody
-
- Target
- DSCR4
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
-
This DSCR4 antibody is un-conjugated
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Purpose
- Rabbit polyclonal antibody raised against recombinant DSCR4.
- Cross-Reactivity
- Human
- Immunogen
-
immunogen: Recombinant protein corresponding to amino acids of human DSCR4.
Immunogen Sequence: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGR
- Isotype
- IgG
-
-
- Application Notes
-
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Target
- DSCR4
- Alternative Name
- DSCR4 (DSCR4 Antibody Abstract)
- Synonyms
- DCRB, DSCRB, Down syndrome critical region 4, DSCR4
- Background
-
Full Gene Name: Down syndrome critical region gene 4
Synonyms: DCRB,DSCRB - Gene ID
- 10281
- UniProt
- P56555