SDK1 antibody (Sidekick Homolog 1, Cell Adhesion Molecule)

Details for Product anti-SDK1 Antibody No. ABIN5587620
Antigen
Reactivity
Human
3
2
2
2
2
1
1
Host
Rabbit
3
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
3
Options
Purpose Rabbit polyclonal antibody raised against recombinant SDK1.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human SDK1.

Immunogen Sequence: ICNKYNGAVLTESVSLKEKSADASESEATDSDYEDALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRYEAVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTPLTGFSS

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name SDK1 (SDK1 Antibody Abstract)
Background Full Gene Name: sidekick homolog 1, cell adhesion molecule (chicken)
Synonyms: FLJ31425
Gene ID 221935
UniProt Q7Z5N4
Application Notes Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Sidekick Homolog 1, Cell Adhesion Molecule (SDK1) antibody (ABIN5587620) Immunohistochemical staining of human rectum with SDK1 polyclonal antibody shows mod...