TAF4B antibody (TAF4B RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor)

Catalog No. ABIN5589176

Product Details anti-TAF4B Antibody

Target: TAF4B

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAF4B antibody is un-conjugated

Application: Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit polyclonal antibody raised against recombinant TAF4B.

Cross-Reactivity: Human

Immunogen:

immunogen: Recombinant protein corresponding to amino acids of human TAF4B.

Immunogen Sequence: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT

Isotype: IgG

Application Details

Application Notes: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 μg/mL)
The optimal working dilution should be determined by the end user.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.

Target Details for TAF4B

Target: TAF4B

Alternative Name: TAF4B (TAF4B Products)

Synonyms: TAF2C2, TAFII105, TATA-box binding protein associated factor 4b, TAF4B

Background: Full Gene Name: TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105 kDa
Synonyms: TAF2C2,TAFII105

Gene ID:

UniProt: Q92750