Trichohyalin antibody (TCHH)

Details for Product anti-TCHH Antibody No. ABIN5589269
Antigen
Reactivity
Human
5
3
1
Host
Rabbit
3
2
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
5
3
2
2
2
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant TCHH.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human TCHH.

Immunogen Sequence: QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name TCHH (TCHH Antibody Abstract)
Background Full Gene Name: trichohyalin
Synonyms: MGC157889,MGC157890,THH,THL
Gene ID 7062
UniProt Q07283
Application Notes Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Trichohyalin (TCHH) antibody (ABIN5589269) Immunohistochemical staining of human placenta with TCHH polyclonal antibody shows s...