Zinc Finger Protein 285A (ZNF285A) antibody Primary Antibody
ZNF285A
Reactivity: Human
IF, IHC (p)
Host: Rabbit
Polyclonal
camera_alt 2
Catalog No. ABIN5591328
$577.33
Plus shipping costs $45.00
100 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- Un-conjugated
- Application
- Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit polyclonal antibody raised against recombinant ZNF285
- Cross-Reactivity
- Human
- Immunogen
immunogen: Recombinant protein corresponding to amino acids of human ZNF285
Immunogen Sequence: EREEKLLMVETETPRDGCSGRKNQQKMESIQEVTVSYFSPKELSSRQTWQQSAGGLIRCQDFLKVFQGKNSQLQEQGNSLGQVWAGIPVQISEDKNYIFTHIGNGSNYIKSQGYPSWRAHHSWRKMYLKESHNYQCRCQQI
- Isotype
- IgG
-
-
- Application Notes
- Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 μg/mL)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2, (40 % glycerol, 0.02 % sodium azide)
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- ZNF285 (ZNF285A Antibody Abstract)
- Synonyms
- ZNF285A, zinc finger protein 285, ZNF285
- Background
- Full Gene Name: zinc finger protein 285A
Synonyms: FLJ30747,ZNF285 - Gene ID
- 26974
You are here: