Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Zinc Finger Protein 330 (ZNF330) antibody Primary Antibody

ZNF330 Reactivity: Human IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5591339
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Zinc Finger Protein 330 (ZNF330)
    Reactivity
    Human
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    • 2
    • 1
    Clonality
    Polyclonal
    • 3
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Purpose
    Rabbit polyclonal antibody raised against recombinant ZNF330.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human ZNF330.

    Immunogen Sequence: SCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHD

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:50-1:200)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    Zinc Finger Protein 330 (ZNF330)
    Alternative Name
    ZNF330 ()
    Synonyms
    HSA6591, NOA36, BC008086, Noa36, Znf330, noa36, MGC52918, zgc:56308, zgc:86920, hm:zeh1201, hsa6591, MGC89433, ZNF330, zinc finger protein 330, zinc finger protein 330 S homeolog, ZNF330, Zfp330, znf330.S, znf330, Znf330
    Background
    Full Gene Name: zinc finger protein 330
    Synonyms: HSA6591,NOA36
    Gene ID
    27309
    UniProt
    Q9Y3S2
You are here:
help Support