ABCA4 antibody (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4) (AA 2174-2273) Primary Antibody
ABCA4
Reactivity: Human
ELISA, WB
Host: Mouse
Polyclonal
unconjugated
camera_alt 2
Catalog No. ABIN559734
$238.67
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- ABCA4
- Binding Specificity
- AA 2174-2273
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- This ABCA4 antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a partial recombinant ABCA4.
- Cross-Reactivity
- Human
- Immunogen
immunogen: ABCA4 (NP_000341, 2174 a.a. ~ 2273 a.a) partial recombinant protein with GST tag.
Immunogen Sequence: PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDLPLHPRAAGASRQAQD
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 50 % glycerol
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- ABCA4
- Alternative Name
- ABCA4 (ABCA4 Antibody Abstract)
- Synonyms
- ABC10, ABCR, ARMD2, CORD3, FFM, RMP, RP19, STGD, STGD1, AW050280, Abc10, Abcr, D430003I15Rik, RmP, abcr, ffm, rmp, rp19, stgd, abc10, armd2, cord3, stgd1, zgc:91823, ATP binding cassette subfamily A member 4, ATP-binding cassette, sub-family A (ABC1), member 4, ATP binding cassette subfamily A member 4 L homeolog, ATP-binding cassette, sub-family A (ABC1), member 4a, ABCA4, Abca4, abca4, abca4.L, abca4a
- Background
- Full Gene Name: ATP-binding cassette, sub-family A (ABC1), member 4
Synonyms: ABC10,ABCR,ARMD2,CORD3,DKFZp781N1972,FFM,FLJ17534,RMP,RP19,STGD,STGD1 - Gene ID
- 24
- NCBI Accession
- NP_000341, NM_000350
You are here: