TUB antibody (AA 395-429)

Catalog No. ABIN5647049

Product Details anti-TUB Antibody

Target: TUB (Tubby Homolog (TUB))

Binding Specificity: AA 395-429

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUB antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 395-429 (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT) from the human protein were used as the immunogen for the Tubby antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Tubby antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Tubby antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for TUB

Target: TUB (Tubby Homolog (TUB))

Alternative Name: Tubby (TUB Products)

Synonyms: rd5 antibody, tubby antibody, MGC79522 antibody, TUB antibody, MGC80126 antibody, MGC84061 antibody, tub antibody, tubby bipartite transcription factor antibody, tubby bipartite transcription factor S homeolog antibody, tub antibody, TUB antibody, tub.S antibody, Tub antibody

Background: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

UniProt: P50607

Pathways: RTK Signaling, Sensory Perception of Sound