HLA-DQB1 antibody

Catalog No. ABIN5647144

Product Details anti-HLA-DQB1 Antibody

Target: HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1 (HLA-DQB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HLA-DQB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR were used as the immunogen for the HLA-DQB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HLA-DQB1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HLA-DQB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HLA-DQB1

Target: HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1 (HLA-DQB1))

Alternative Name: HLA-DQB1 (HLA-DQB1 Products)

Synonyms: CELIAC1 antibody, HLA-DQB antibody, IDDM1 antibody, mhc-DRB antibody, DLA-DQB antibody, MAMU-DQB1 antibody, LOC100172120 antibody, DKFZp469C0237 antibody, major histocompatibility complex, class II, DQ beta 1 antibody, HLA-DQB1 antibody, PATR-DQB1 antibody, DLA-DQB1 antibody, MAMU-DQB1 antibody, LOC100172120 antibody

Background: Major histocompatibility complex, class II, DQ beta 1, also known as HLA-DQB1, is a human gene and also denotes the genetic locus that contains this gene. HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.

UniProt: P01920

Pathways: TCR Signaling, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints