Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RPS6 antibody (AA 13-52)

The Rabbit Polyclonal anti-RPS6 antibody (ABIN5647262) specifically detects RPS6 in WB and IHC (p). The antibody is reactive with Human, Mouse and Rat samples.
Catalog No. ABIN5647262
$625.62
Plus shipping costs $50.00
100 μg
Shipping to: United States
Delivery in 2 to 3 Business Days

Quick Overview for RPS6 antibody (AA 13-52) (ABIN5647262)

Target

See all RPS6 Antibodies
RPS6 (Ribosomal Protein S6 (RPS6))

Reactivity

  • 142
  • 131
  • 118
  • 12
  • 12
  • 10
  • 10
  • 10
  • 8
  • 8
  • 7
  • 7
  • 5
  • 5
  • 5
  • 4
  • 2
  • 2
  • 2
  • 1
Human, Mouse, Rat

Host

  • 161
  • 10
  • 2
  • 2
Rabbit

Clonality

  • 143
  • 32
Polyclonal

Conjugate

  • 81
  • 11
  • 8
  • 6
  • 5
  • 5
  • 4
  • 4
  • 4
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 2
  • 2
This RPS6 antibody is un-conjugated

Application

  • 151
  • 58
  • 56
  • 43
  • 40
  • 40
  • 27
  • 27
  • 20
  • 17
  • 11
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Binding Specificity

    • 47
    • 29
    • 27
    • 25
    • 15
    • 14
    • 13
    • 9
    • 9
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 13-52

    Purification

    Antigen affinity purified

    Immunogen

    Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.

    Isotype

    IgG
  • Application Notes

    Optimal dilution of the RPS6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Storage

    -20 °C

    Storage Comment

    After reconstitution, the RPS6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    RPS6 (Ribosomal Protein S6 (RPS6))

    Alternative Name

    RPS6

    Background

    Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

    UniProt

    P62753

    Pathways

    Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
You are here:
Chat with us!