ARHGEF1 antibody (AA 41-71)

Catalog No. ABIN5647328

This anti-ARHGEF1 antibody is a Rabbit Polyclonal antibody detecting ARHGEF1 in WB and IHC (p). Suitable for Human, Mouse and Rat.

Quick Overview for ARHGEF1 antibody (AA 41-71) (ABIN5647328)

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGEF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ARHGEF1 Antibody

Binding Specificity: AA 41-71

Purification: Antigen affinity purified

Immunogen: Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ARHGEF1

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Alternative Name: ARHGEF1

Background: Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

UniProt: Q92888

Pathways: Neurotrophin Signaling Pathway, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling