Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

BAX antibody (AA 17-48)

This Rabbit Polyclonal antibody specifically detects BAX in WB, FACS and IHC (p). It exhibits reactivity toward Human, Mouse and Rat.
Catalog No. ABIN5647494
$625.62
Plus shipping costs $50.00
100 μg
Shipping to: United States
Delivery in 2 to 4 Business Days

Quick Overview for BAX antibody (AA 17-48) (ABIN5647494)

Target

See all BAX Antibodies
BAX (BCL2-Associated X Protein (BAX))

Reactivity

  • 257
  • 166
  • 146
  • 45
  • 28
  • 26
  • 23
  • 19
  • 16
  • 11
  • 9
  • 8
  • 4
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Mouse, Rat

Host

  • 166
  • 99
  • 3
  • 2
  • 1
Rabbit

Clonality

  • 164
  • 107
Polyclonal

Conjugate

  • 142
  • 14
  • 11
  • 9
  • 7
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
This BAX antibody is un-conjugated

Application

  • 232
  • 95
  • 89
  • 76
  • 53
  • 52
  • 49
  • 46
  • 39
  • 14
  • 12
  • 8
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Binding Specificity

    • 32
    • 24
    • 19
    • 17
    • 15
    • 12
    • 10
    • 10
    • 8
    • 8
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 17-48

    Purification

    Antigen affinity purified

    Immunogen

    Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

    Isotype

    IgG
  • Application Notes

    Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Storage

    -20 °C

    Storage Comment

    After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    BAX (BCL2-Associated X Protein (BAX))

    Alternative Name

    Bax

    Background

    Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

    UniProt

    Q07812

    Pathways

    p53 Signaling, PI3K-Akt Signaling, Apoptosis, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
You are here:
Chat with us!