IL-6 Receptor antibody (AA 379-419)

Catalog No. ABIN5647855

The Rabbit Polyclonal anti-IL-6 Receptor antibody is suitable to detect IL-6 Receptor in samples from Human. It has been validated for WB.

Quick Overview for IL-6 Receptor antibody (AA 379-419) (ABIN5647855)

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-6 Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL-6 Receptor Antibody

Binding Specificity: AA 379-419

Purpose: IL6R Antibody (C-Terminal Region)

Sequence: LLCIAIVLRF KKTWKLRALK EGKTSMHPPY SLGQLVPERP R

Purification: Antigen affinity

Immunogen: Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IL6R antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the IL6R antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for IL-6 Receptor

Target: IL-6 Receptor (IL6R) (Interleukin 6 Receptor (IL6R))

Alternative Name: IL6R

Background: Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.

UniProt: P08887

Pathways: JAK-STAT Signaling, Autophagy, Growth Factor Binding, Cancer Immune Checkpoints