PDE5A antibody (AA 20-63)

Catalog No. ABIN5647895

Product Details anti-PDE5A Antibody

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Binding Specificity: AA 20-63

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE5A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 20-63 (QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) from the human protein were used as the immunogen for the PDE5A antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PDE5A antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PDE5A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PDE5A

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Alternative Name: PDE5 (PDE5A Products)

Synonyms: CGB-PDE antibody, CN5A antibody, PDE5 antibody, PDE5A2 antibody, Cgbpde antibody, Cn5n antibody, Pde5 antibody, Pde5a1 antibody, PDE5A antibody, pde5a antibody, cgb-pde antibody, cn5a antibody, pde5 antibody, pde5a1 antibody, phosphodiesterase 5A antibody, phosphodiesterase 5A, cGMP-specific antibody, phosphodiesterase 5A S homeolog antibody, phosphodiesterase 5A, cGMP-specific, b antibody, PDE5A antibody, Pde5a antibody, pde5a.S antibody, pde5ab antibody, pde5a antibody

Background: CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

UniProt: O76074

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling