INPP5D antibody
-
- Target See all INPP5D Antibodies
- INPP5D (Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This INPP5D antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Brand
- Picoband™
- Sequence
- NEDDKFTVQA SEGVSMRFFT KLDQLIEFYK KENMGLVTHL Q
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for SHIP detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ).
- Top Product
- Discover our top product INPP5D Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- INPP5D (Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D))
- Alternative Name
- INPP5D (INPP5D Products)
- Synonyms
- INPP5D antibody, 256.t00004 antibody, 13.t00027 antibody, ship antibody, ship1 antibody, AI323613 antibody, SHIP antibody, SHIP-1 antibody, SHIP1 antibody, s-SHIP antibody, SIP-145 antibody, hp51CN antibody, inositol polyphosphate-5-phosphatase D antibody, phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 antibody, inositol polyphosphate 5-phosphatase antibody, inositol polyphosphate-5-phosphatase D L homeolog antibody, INPP5D antibody, LOC100446045 antibody, inpp5d antibody, EHI_159880 antibody, EHI_153490 antibody, inpp5d.L antibody, LOC100380693 antibody, Inpp5d antibody
- Background
-
Synonyms: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1, Inositol polyphosphate-5-phosphatase of 145 kDa, SIP-145, SH2 domain-containing inositol 5'-phosphatase 1, SH2 domain-containing inositol phosphatase 1, SHIP-1, p150Ship, hp51CN, INPP5D, SHIP, SHIP1
Tissue Specificity: Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this compartment. Present in at least 74 % of immature CD34+ cells, whereas within the more mature population of CD33+ cells, it is present in only 10 % of cells. Present in the majority of T-cells, while it is present in a minority of B-cells (at protein level).
Background: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 is an enzyme that in humans is encoded by the INPP5D gene. This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system.
- UniProt
- Q92835
- Pathways
- TCR Signaling, BCR Signaling, Warburg Effect
-