CCT3 antibody (C-Term)
-
- Target See all CCT3 Antibodies
- CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))
-
Binding Specificity
- AA 497-536, C-Term
-
Reactivity
- Human
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This CCT3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Brand
- Picoband™
- Sequence
- EPLAVKLQTY KTAVETAVLL LRIDDIVSGH KKKGDDQSRQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Mouse IgG monoclonal antibody for CCT3 detection. Tested with WB in Human.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
- Clone
- 12H4
- Isotype
- IgG1
- Top Product
- Discover our top product CCT3 Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))
- Alternative Name
- CCT3 (CCT3 Products)
- Synonyms
- chunp6930 antibody, wu:fb13f04 antibody, wu:fb52a02 antibody, wu:fj48b06 antibody, NV18778 antibody, CCT-gamma antibody, CCTG antibody, PIG48 antibody, TCP-1-gamma antibody, TRIC5 antibody, AL024092 antibody, Cctg antibody, Tcp1-rs3 antibody, TriC-P5 antibody, chaperonin containing TCP1, subunit 3 (gamma) antibody, T-complex protein 1 subunit gamma antibody, chaperonin containing TCP1 subunit 3 L homeolog antibody, chaperonin containing TCP1 subunit 3 antibody, chaperonin containing Tcp1, subunit 3 (gamma) antibody, cct3 antibody, CC1G_11423 antibody, Cctgamma antibody, tcpg antibody, cct3.L antibody, CCT3 antibody, Cct3 antibody
- Background
-
Synonyms: T-complex protein 1 subunit gamma, TCP-1-gamma, CCT-gamma, hTRiC5, CCT3, CCTG, TRIC5
Background: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
- UniProt
- P49368
-