KCNH1 antibody

Catalog No. ABIN5693254

Product Details anti-KCNH1 Antibody

Target: KCNH1 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 1 (KCNH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNH1 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: AKRKSWARFK DACGKSEDWN KVSKAESMET LPERTKA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for KCNH1 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for KCNH1

Target: KCNH1 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 1 (KCNH1))

Alternative Name: KCNH1 (KCNH1 Products)

Synonyms: EAG antibody, bEAG antibody, EAG1 antibody, Kv10.1 antibody, h-eag antibody, M-eag antibody, Eag1 antibody, kcnh1 antibody, potassium voltage-gated channel subfamily H member 1 antibody, potassium channel, voltage gated eag related subfamily H, member 1 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 1 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 1a antibody, KCNH1 antibody, LOC490277 antibody, Kcnh1 antibody, kcnh1a antibody

Background:

Synonyms: Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1

Tissue Specificity: Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.

Background: Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.

UniProt: O95259