NR1I3 antibody (N-Term)

Catalog No. ABIN629575

Product Details anti-NR1I3 Antibody

Target: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1I3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NR1 I3 antibody was raised against the N terminal of NR1 3

Purification: Purified

Immunogen: NR1 I3 antibody was raised using the N terminal of NR1 3 corresponding to a region with amino acids MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR1I3 Blocking Peptide, catalog no. 33R-5759, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR1I3

Target: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Alternative Name: NR1I3 (NR1I3 Products)

Synonyms: AA209988 antibody, AI551208 antibody, CAR antibody, CAR-beta antibody, Care2 antibody, ESTM32 antibody, MB67 antibody, CAR1 antibody, CXR antibody, nuclear receptor subfamily 1 group I member 3 antibody, nuclear receptor subfamily 1, group I, member 3 antibody, NR1I3 antibody, Nr1i3 antibody

Background: NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway