RUNX2 antibody (Middle Region)

Catalog No. ABIN629583

This anti-RUNX2 antibody is a Rabbit Polyclonal antibody detecting RUNX2 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for RUNX2 antibody (Middle Region) (ABIN629583)

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RUNX2 Antibody

Binding Specificity: Middle Region

Specificity: RUNX2 antibody was raised against the middle region of RUNX2

Purification: Purified

Immunogen: RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RUNX2 Blocking Peptide, (ABIN937574), is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUNX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RUNX2

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Alternative Name: RUNX2

Background: RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.

Molecular Weight: 57 kDa (MW of target protein)