WNT2B antibody (Middle Region)

Catalog No. ABIN629639

Product Details anti-WNT2B Antibody

Target: WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT2B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: WNT2 B antibody was raised against the middle region of WNT2

Purification: Purified

Immunogen: WNT2 B antibody was raised using the middle region of WNT2 corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT2B

Target: WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))

Alternative Name: WNT2B (WNT2B Products)

Synonyms: WNT13 antibody, XWNT2 antibody, wnt2b antibody, XWnt-2 antibody, Xwnt-2b antibody, wnt-2b antibody, xwnt2b antibody, WNT2B antibody, Wnt13 antibody, Wnt family member 2B antibody, wingless-type MMTV integration site family, member 2Ba antibody, Wnt family member 2B L homeolog antibody, wingless-type MMTV integration site family, member 2B antibody, wingless-type MMTV integration site family, member 2Bb antibody, WNT2B antibody, Wnt2b antibody, wnt2ba antibody, wnt2b.L antibody, wnt2bb antibody

Background: WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: WNT Signaling