CPS1 antibody (N-Term)

Catalog No. ABIN629684

Product Details anti-CPS1 Antibody

Target: CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CPS1 antibody was raised against the N terminal of CPS1

Purification: Purified

Immunogen: CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPS1 Blocking Peptide, catalog no. 33R-7787, is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPS1

Target: CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))

Alternative Name: CPS1 (CPS1 Products)

Synonyms: CPSASE1 antibody, cps antibody, 4732433M03Rik antibody, CPS antibody, D1Ucla3 antibody, Cps1 antibody, carbamoyl-phosphate synthase 1 antibody, carbamoyl-phosphate synthase 1 L homeolog antibody, carbamoyl-phosphate synthetase 1 antibody, peptidase M20 domain containing 1 antibody, CPS1 antibody, Cps1 antibody, cps1.L antibody, cps1 antibody, PM20D1 antibody

Background: Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.

Molecular Weight: 165 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Glucan Metabolic Process