NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) antibody

Catalog No. ABIN629701

This Rabbit Polyclonal antibody specifically detects NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) antibody (ABIN629701)

Target: NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: NELF antibody was raised against the middle region of NELF

Purification: Purified

Immunogen: NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NELF Blocking Peptide, (ABIN5614955), is also available for use as a blocking control in assays to test for specificity of this NELF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Alternative Name: NELF

Background: NELF influences outgrowth of olfactory axons and migration of LHRH neurons.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Synaptic Membrane