NSUN5P2 antibody (Middle Region)

Catalog No. ABIN629781

Product Details anti-NSUN5P2 Antibody

Target: NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSUN5P2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NSUN5 C antibody was raised against the middle region of NSUN5

Purification: Purified

Immunogen: NSUN5 C antibody was raised using the middle region of NSUN5 corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSUN5C Blocking Peptide, catalog no. 33R-6965, is also available for use as a blocking control in assays to test for specificity of this NSUN5C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSUN5P2

Target: NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))

Alternative Name: NSUN5C (NSUN5P2 Products)

Synonyms: NOL1R2 antibody, NSUN5C antibody, WBSCR20B antibody, WBSCR20C antibody, NOP2/Sun RNA methyltransferase family member 5 pseudogene 2 antibody, NSUN5P2 antibody

Background: NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.

Molecular Weight: 34 kDa (MW of target protein)