EXD (C-Term) antibody

Catalog No. ABIN629819

Product Details

Target: EXD

Binding Specificity: C-Term

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: EXD antibody was raised against the C terminal Of Exd

Purification: Purified

Immunogen: EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXD Blocking Peptide, catalog no. 33R-2263, is also available for use as a blocking control in assays to test for specificity of this EXD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: EXD

Synonyms: CG8933 antibody, DExd antibody, Dm-EXD antibody, Dmel\CG8933 antibody, Dpbx antibody, EXD antibody, Exd antibody, Pbx1 antibody, anon-EST:fe1H3 antibody, l(1)IV antibody, lincRNA.S9404 antibody, td48 antibody, extradenticle antibody, exd antibody

Background: As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.

Molecular Weight: 42 kDa (MW of target protein)