MAP3K7CL antibody (C-Term)

Catalog No. ABIN629829

Product Details anti-MAP3K7CL Antibody

Target: MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP3K7CL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: C21 ORF7 antibody was raised against the C terminal Of C21 rf7

Purification: Purified

Immunogen: C21 ORF7 antibody was raised using the C terminal Of C21 rf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF7 Blocking Peptide, catalog no. 33R-2161, is also available for use as a blocking control in assays to test for specificity of this C21ORF7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP3K7CL

Target: MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))

Alternative Name: C21ORF7 (MAP3K7CL Products)

Synonyms: C21orf7 antibody, ORF63 antibody, Tak1l antibody, Map3k7 C-terminal like antibody, Map3k7cl antibody

Background: C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.

Molecular Weight: 27 kDa (MW of target protein)