SERPINB5 antibody
-
- Target See all SERPINB5 Antibodies
- SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SERPINB5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
- Top Product
- Discover our top product SERPINB5 Primary Antibody
-
-
- Application Notes
-
WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SERPINB5 Blocking Peptide, catalog no. 33R-6892, is also available for use as a blocking control in assays to test for specificity of this SERPINB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))
- Alternative Name
- SERPINB5 (SERPINB5 Products)
- Background
- As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- p53 Signaling
-