NXF3 antibody (C-Term)

Catalog No. ABIN629937

Product Details anti-NXF3 Antibody

Target: NXF3 (Nuclear RNA Export Factor 3 (NXF3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NXF3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NXF3 antibody was raised against the C terminal of NXF3

Purification: Purified

Immunogen: NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NXF3 Blocking Peptide, catalog no. 33R-8801, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NXF3

Target: NXF3 (Nuclear RNA Export Factor 3 (NXF3))

Alternative Name: NXF3 (NXF3 Products)

Synonyms: NXF3 antibody, Gm384 antibody, RGD1564923 antibody, nuclear RNA export factor 3 antibody, NXF3 antibody, LOC523530 antibody, LOC100060140 antibody, LOC100060240 antibody, LOC785244 antibody, Nxf3 antibody

Background: NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.

Molecular Weight: 58 kDa (MW of target protein)