TRA2B antibody
-
- Target See all TRA2B Antibodies
- TRA2B (Transformer 2 beta Homolog (TRA2B))
-
Reactivity
- Human, Mouse, Dog, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRA2B antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
- Top Product
- Discover our top product TRA2B Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS10 Blocking Peptide, catalog no. 33R-3636, is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRA2B (Transformer 2 beta Homolog (TRA2B))
- Alternative Name
- SFRS10 (TRA2B Products)
- Synonyms
- sfrs10 antibody, SFRS10 antibody, Htra2-beta antibody, SRFS10 antibody, TRA2-BETA antibody, TRAN2B antibody, 5730405G21Rik antibody, D16Ertd266e antibody, SIG-41 antibody, Sfrs10 antibody, Silg41 antibody, TRA2beta antibody, Srsf10 antibody, zgc:56612 antibody, transformer 2 beta homolog (Drosophila) antibody, transformer 2 beta homolog L homeolog antibody, transformer 2 beta homolog antibody, tra2b antibody, tra2b.L antibody, TRA2B antibody, Tra2b antibody
- Background
- SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
- Molecular Weight
- 32 kDa (MW of target protein)
-