SNRNP35 antibody (N-Term)

Catalog No. ABIN630009

Product Details anti-SNRNP35 Antibody

Target: SNRNP35 (U11/U12 SnRNP 35 KDa Protein)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRNP35 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: U1 SNRNPBP antibody was raised against the N terminal of U1 NRNPBP

Purification: Purified

Immunogen: U1 SNRNPBP antibody was raised using the N terminal of U1 NRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

U1SNRNPBP Blocking Peptide, catalog no. 33R-7830, is also available for use as a blocking control in assays to test for specificity of this U1SNRNPBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 NRNPBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRNP35

Target: SNRNP35 (U11/U12 SnRNP 35 KDa Protein)

Alternative Name: U1SNRNPBP (SNRNP35 Products)

Synonyms: MGC154877 antibody, u1snrnpbp antibody, RGD1310724 antibody, U1snrnpbp antibody, 6330548G22Rik antibody, zgc:112337 antibody, HM-1 antibody, U1SNRNPBP antibody, small nuclear ribonucleoprotein U11/U12 subunit 35 L homeolog antibody, small nuclear ribonucleoprotein U11/U12 subunit 35 antibody, small nuclear ribonucleoprotein 35 (U11/U12) antibody, snrnp35.L antibody, Snrnp35 antibody, snrnp35 antibody, SNRNP35 antibody

Background: U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.

Molecular Weight: 28 kDa (MW of target protein)