CLIC5 antibody (C-Term)

Catalog No. ABIN630075

This anti-CLIC5 antibody is a Rabbit Polyclonal antibody detecting CLIC5 in WB and IHC. Suitable for Human.

Quick Overview for CLIC5 antibody (C-Term) (ABIN630075)

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CLIC5 Antibody

Binding Specificity: C-Term

Specificity: CLIC5 antibody was raised against the C terminal of CLIC5

Purification: Purified

Immunogen: CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC5 Blocking Peptide, (ABIN936202), is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC5

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Alternative Name: CLIC5

Background: Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Sensory Perception of Sound