CLIC5 antibody (Middle Region)

Catalog No. ABIN630088

This Rabbit Polyclonal antibody specifically detects CLIC5 in WB and IHC. It exhibits reactivity toward Human and Mouse.

Quick Overview for CLIC5 antibody (Middle Region) (ABIN630088)

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CLIC5 Antibody

Binding Specificity: Middle Region

Specificity: CLIC5 antibody was raised against the middle region of CLIC5

Purification: Purified

Immunogen: CLIC5 antibody was raised using the middle region of CLIC5 corresponding to a region with amino acids HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC5 Blocking Peptide, (ABIN939201), is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC5

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Alternative Name: CLIC5

Background: CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Sensory Perception of Sound