CHRNA7 antibody (Middle Region)

Catalog No. ABIN630113

The Rabbit Polyclonal anti-CHRNA7 antibody has been validated for WB. It is suitable to detect CHRNA7 in samples from Human.

Quick Overview for CHRNA7 antibody (Middle Region) (ABIN630113)

Target: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHRNA7 Antibody

Binding Specificity: Middle Region

Specificity: CHRNA7 antibody was raised against the middle region of CHRNA7

Purification: Purified

Immunogen: CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA7 Blocking Peptide, (ABIN5612868), is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA7

Target: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Alternative Name: CHRNA7

Background: The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane