RED1 antibody
-
- Target See all RED1 (ADARB1) Antibodies
- RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RED1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
- Top Product
- Discover our top product ADARB1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADARB1 Blocking Peptide, catalog no. 33R-7645, is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))
- Alternative Name
- ADARB1 (ADARB1 Products)
- Synonyms
- ADARB1 antibody, RED1 antibody, ADAR2 antibody, DRABA2 antibody, DRADA2 antibody, 1700057H01Rik antibody, AW124433 antibody, AW558573 antibody, Adar2 antibody, BB220382 antibody, D10Bwg0447e antibody, Red1 antibody, adar2 antibody, adarb1 antibody, red1 antibody, adenosine deaminase, RNA specific B1 antibody, adenosine deaminase, RNA-specific, B1 antibody, adenosine deaminase, RNA-specific, B1 L homeolog antibody, adenosine deaminase, RNA-specific, B1a antibody, ADARB1 antibody, adarb1 antibody, adarb1.L antibody, Adarb1 antibody, adarb1a antibody
- Background
- ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.
- Molecular Weight
- 77 kDa (MW of target protein)
-