GOT2 antibody

Catalog No. ABIN630134

Product Details anti-GOT2 Antibody

Target: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOT2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOT2 Blocking Peptide, catalog no. 33R-7247, is also available for use as a blocking control in assays to test for specificity of this GOT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOT2

Target: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Alternative Name: GOT2 (GOT2 Products)

Synonyms: KAT4 antibody, KATIV antibody, mitAAT antibody, AI789014 antibody, Got-1 antibody, cAspAT antibody, cCAT antibody, AL022787 antibody, FABP-pm antibody, Got-2 antibody, mAspAT antibody, ASPATA antibody, got2 antibody, zgc:66329 antibody, fj40h07 antibody, wu:fj40h07 antibody, zgc:56425 antibody, glutamic-oxaloacetic transaminase 2 antibody, glutamic-oxaloacetic transaminase 1, soluble antibody, glutamatic-oxaloacetic transaminase 2, mitochondrial antibody, glutamic-oxaloacetic transaminase 2a, mitochondrial antibody, glutamic-oxaloacetic transaminase 2 L homeolog antibody, Aspartate amino transferase activity antibody, glutamic-oxaloacetic transaminase 2b, mitochondrial antibody, GOT2 antibody, got2 antibody, Got1 antibody, Got2 antibody, got2a antibody, got2.L antibody, AST antibody, got2b antibody

Background: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process