MCM6 antibody (C-Term)

Catalog No. ABIN630187

Product Details anti-MCM6 Antibody

Target: MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MCM6 antibody was raised against the C terminal of MCM6

Purification: Purified

Immunogen: MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM6 Blocking Peptide, catalog no. 33R-7967, is also available for use as a blocking control in assays to test for specificity of this MCM6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM6

Target: MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))

Alternative Name: MCM6 (MCM6 Products)

Synonyms: CG4039 antibody, DmMCM6 antibody, DmeMCM6 antibody, Dmel\\CG4039 antibody, MCM6 antibody, McM6 antibody, fs(1)K1214 antibody, mcm6 antibody, MCG40308 antibody, Mis5 antibody, P105MCM antibody, Mcmd6 antibody, mis5 antibody, mmcm6 antibody, ASP-l1 antibody, D1Wsu22e antibody, Minichromosome maintenance 6 antibody, DNA replication licensing factor MCM6 antibody, minichromosome maintenance complex component 6 antibody, minichromosome maintenance complex component 6 L homeolog antibody, DNA replication licensing factor mcm-6 antibody, Mcm6 antibody, TP02_0113 antibody, PVX_114735 antibody, CMU_027970 antibody, MCM6 antibody, mcm6.L antibody, mcm-6 antibody

Background: The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA