PIK3R3 antibody
-
- Target See all PIK3R3 Antibodies
- PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIK3R3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PIK3 R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE
- Top Product
- Discover our top product PIK3R3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIK3R3 Blocking Peptide, catalog no. 33R-2832, is also available for use as a blocking control in assays to test for specificity of this PIK3R3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))
- Alternative Name
- PIK3R3 (PIK3R3 Products)
- Synonyms
- AA414954 antibody, p55pik antibody, p55 antibody, p55-GAMMA antibody, pik3r3 antibody, zgc:55564 antibody, zgc:85710 antibody, phosphoinositide-3-kinase regulatory subunit 3 antibody, phosphoinositide-3-kinase, regulatory subunit 3 (gamma) antibody, phosphoinositide-3-kinase, regulatory subunit 3b (gamma) antibody, PIK3R3 antibody, Pik3r3 antibody, pik3r3b antibody
- Background
- PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
- Molecular Weight
- 54 kDa (MW of target protein)
-