Annexin A13 antibody (N-Term)
-
- Target See all Annexin A13 (ANXA13) Antibodies
- Annexin A13 (ANXA13)
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin A13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Annexin A13 antibody was raised against the N terminal of ANXA13
- Cross-Reactivity
- Human
- Purification
- Purified
- Immunogen
- Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE
- Top Product
- Discover our top product ANXA13 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A13 Blocking Peptide, catalog no. 33R-2628, is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin A13 (ANXA13)
- Alternative Name
- Annexin A13 (ANXA13 Products)
- Synonyms
- ANX13 antibody, ISA antibody, anxa6 antibody, MGC82170 antibody, 1810034H17Rik antibody, AV055219 antibody, anx13 antibody, wu:fb40a08 antibody, ANXA13 antibody, MGC108373 antibody, annexin A13 antibody, annexin A13 L homeolog antibody, ANXA13 antibody, anxa13.L antibody, Anxa13 antibody, anxa13 antibody, PAAG_01138 antibody
- Target Type
- Chemical
- Background
- ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.
- Molecular Weight
- 39 kDa (MW of target protein)
-