GJC1 antibody (N-Term)

Catalog No. ABIN630269

Product Details anti-GJC1 Antibody

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJC1 antibody was raised against the N terminal of GJC1

Purification: Purified

Immunogen: GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJC1 Blocking Peptide, catalog no. 33R-3961, is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJC1

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Alternative Name: GJC1 (GJC1 Products)

Synonyms: CX45 antibody, GJA7 antibody, cx45 antibody, gja7 antibody, MGC52735 antibody, GJD3 antibody, GJC1 antibody, C130009G16Rik antibody, Cnx45 antibody, Cx45 antibody, Gja-7 antibody, Gja7 antibody, gap junction protein gamma 1 antibody, gap junction protein gamma 1 L homeolog antibody, gap junction protein, delta 3, 31.9kDa antibody, gap junction protein, gamma 1 antibody, Gap junction gamma-1 protein antibody, GJC1 antibody, gjc1.L antibody, GJD3 antibody, Gjc1 antibody, gjc1 antibody

Background: CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization