SLC38A1 antibody (Middle Region)
-
- Target See all SLC38A1 Antibodies
- SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC38A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SLC38 A1 antibody was raised against the middle region of SLC38 1
- Purification
- Purified
- Immunogen
- SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN
- Top Product
- Discover our top product SLC38A1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC38A1 Blocking Peptide, catalog no. 33R-5156, is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))
- Alternative Name
- SLC38A1 (SLC38A1 Products)
- Synonyms
- ATA1 antibody, NAT2 antibody, SAT1 antibody, SNAT1 antibody, AA408026 antibody, AA409865 antibody, AL022800 antibody, AU015942 antibody, Ata1 antibody, GlnT antibody, Sat1 antibody, solute carrier family 38 member 1 antibody, solute carrier family 38, member 1 antibody, SLC38A1 antibody, Slc38a1 antibody
- Background
- Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
- Molecular Weight
- 54 kDa (MW of target protein)
-